To GoodData homepage

SDKs and APIs

SDKs and APIs

  • 20 Topics
  • 107 Replies

20 Topics

mares
maresParticipating Frequently
asked in SDKs and APIs

Export Dashboard via rest api

Good one every one,Can any1 spot which is the problem on the following code?, trying to test how GoodData exports a dashboard to a PDF. def post_request(url, data): response = requests.post( url, data=data, headers={'Authorization': 'Bearer ' + auth_token, 'Content-type': 'application/json'} , timeout=30)result = post_request( HOST_URL + '/api/v1/actions/workspaces/' + WORKSPACE_ID + '/export/visual', data={ "dashboardId": DASHBOARD_ID, "fileName": "export_test_01", "metadata": {} }) it's returning No API path found that matches request. Just in case some1 is wondering, token is good as I'm able to retrieve from endpoint '/api/v1/entities/workspaces' the workspaces, but when trying to perform the post above it's not working.  

1
Moises Morales
GoodData Employee
1 month ago
SasalMarcon
SasalMarconParticipating Frequently
asked in SDKs and APIs

How to use gooddata API with node js

I tried calling gooddata API with necessary headers using node js but it is showing error 401. If possible it will be really helpful to get a sample code

7
SasalMarcon
1 month ago
SasalMarcon
SasalMarconParticipating Frequently
asked in SDKs and APIs

It is made mandatory to include User-Agent header as mentioned in documentation. What is the general header admin mentioned in documention?

I want to automate the process in gooddata using API in node js . It is mentioned that its mandatory to include User-Agent header and I want to use general Admin Header . What is general admin header?

4
SasalMarcon
1 month ago
scott.jacobsen
scott.jacobsenParticipating Frequently
asked in SDKs and APIs

OIDC silent login failure

Hello, I'm working on setting up OIDC for our gd.cn instance.Unfortunately it isn't working but I can't debug the issue from the GD side.Here is the organization configuration:{    "data": {    "id": "<myorgid>",    "type": "organization",    "attributes": {        "name": "WizeHive",        "hostname": "wizehive.poc.cloud.gooddata.com",        "oauthIssuerLocation": "https://<ourhost.org>/",        "oauthClientId": "jQPiFIaePpt5EQDav00zha_XvPmku2-SltwKcy79-tk",        "oauthClientSecret": "<secret>"    }    }}Much of the login process appears to succeed. Here is a summary of the requests to the OIDC provider:GET /.well-known/openid-configuration200 - OKGET /oauth/authorize?response_type=code&client_id=jQPiFIaePpt5EQDav00zha_XvPmku2-SltwKcy79-tk&scope=openid%20profile&state=RorYXYYc2SsLpFW1w-h9-gjYPQvNxoRRb6Fh6hsjGQY%3D&redirect_uri=https%3A%2F%2Fwizehive.poc.cloud.gooddata.com%2Flogin%2Foauth2%2Fcode%2Fwizehive.poc.cloud.gooddata.com&nonce=M6P7mmX

6
scott.jacobsen
4 months ago
kentteo
kentteoNew Participant
asked in SDKs and APIs

Getting error during Init copy-extra-drivers

Hi all, I am having trouble trying to set up my Gooddata.cn deployment on our GCP infrastructure. I successfully set up an instance (GD v2.0) in my other region a month ago. I am following the deployment guide but this time I am using GD.cn V2.1. I cannot figure out what went wrong.This is the point I got to. Deployed Pulsar, Nginx and GoodData.cn. My Pod for gooddata-cn-sql-executor is not running due to CrashLoopBackOff. And I can see the error happened when trying to run the copy-extra-drivers container. I am using BigQuery in this case. I built my image using busybox and copy drivers by following the exact same guide that worked for me last time. I used kubectl to describe the log for this container and there isn’t much lead for me. Here it is.  Name: gooddata-cn-sql-executor-5dffdbd85b-52vmtNamespace: gooddata-cnPriority: 0Node: <MASKED>Start Time: Mon, 17 Oct 2022 15:06:17 +0800Labels: app.kubernetes.io/component=sqlExecutor app.k

6
R
GoodData Employee
5 months ago
A
alejandro.riveraInspiring
asked in SDKs and APIs

Filter out future empty values

Hello,How can I create a metric that is going to filter empty values like the one below, by if an empty value doesn’t yet exist? In other words how can I make the filter so it filters out future empty values? select Customer Gender where Customer Gender not in ((empty value)) Thanks!

3
Jan Kos
GoodData Employee
7 months ago
P
PD5Known Participant
asked in SDKs and APIs

API Error when creating a PostgreSQL data source

Hi, I'm not sure if anyone can help with this query. I'm currently using the GoodData API to set up a data source, but am receiving this error. It looks like "postgres" isn't a valid option for the connectionInfo even though the documentation says it is. Here is the error{"response":{"error":{"errorClass":"com.gooddata.validator.openapi.spring.exception.MalformedRequestException","trace":"","message":"Malformed request: [ERROR - [Path '/dataSource/connectionInfo'] Instance failed to match exactly one schema (matched 0 out of 10): [/properties/dataSource/properties/connectionInfo/oneOf/0: Object instance has properties which are not allowed by the schema: [\"postgres\"], /properties/dataSource/properties/connectionInfo/oneOf/0: Object has missing required properties ([\"snowflake\"]), /properties/dataSource/properties/connectionInfo/oneOf/1: Object instance has properties which are not allowed by the schema: [\"postgres\"], /properties/dataSource/properties/connectionInfo/oneOf/1: Objec

2
P
7 months ago
A
alejandro.riveraInspiring
asked in SDKs and APIs

How to create report domain?

Hello,Does anybody knows how to create a report folder (also known as domain) via the Ruby SDK?My report structure looks like the one below, I’ve marked in red the resource that I want to create. It seems that this model is only for folders for metrics and facts, not reports.GoodData Resource{   "report" : {      "content" : {         "definitions" : [            "/gdc/md/qplmsdfsdfsdfsdfsdfsdfsdfsdfsdfqv/obj/1111111"         ],         "domains" : [            "/gdc/md/qplmcrc1ytrn3d817ilflrkdgi6gs1qv/obj/241134"         ]      },      "meta" : {         "author" : "/gdc/account/profile/sdfsdfsdf",         "category" : "report",         "contributor" : "/gdc/account/profile/sdfsdfsdf",         "created" : "2022-06-24 19:37:08",         "deprecated" : "0",         "identifier" : "abv6eR9gfcCa",         "isProduction" : 1,         "summary" : "",         "tags" : "",         "title" : "Contacts by Category",         "updated" : "2022-07-14 16:37:07",         "uri" : "/gdc/md/csdfsdfsdff

6
A
8 months ago
A
alejandro.riveraInspiring
asked in SDKs and APIs

Creating Reports via Ruby SDK

Hi, I’m Alejandro :)I'm working on automating report creation via the Ruby SDK.To be able to create reports, I was following these instructions: https://sdk.gooddata.com/gooddata-ruby-doc/docs/working_with_reportsBut this way of creating reports :project.compute_report(left: project.metrics.first, filters: [[label, :not, 'San Francisco', 'Prague']])only allows me to create filters as IN or NOT IN, per what I can see in the method itself.In my case I want to create a report with 2 filters with the expressions: Year is this year    (so this would be Attribute = Value)<attribute > where Contact is Valid is equal to 1. (so this would be attribute where metric is equal to 1)How can I accomplish this? I can't seem to find examples or good enough information related to this or how to do it.I'll appreciate any help,ThanksAlejandro

3
Jan Rehanek
GoodData Employee
8 months ago
A
Aaron DsouzaNew Participant
asked in SDKs and APIs

Application created using Accelerator Toolkit keeps refreshing

I created a react application using the Accelerator toolkit and following this tutorial https://university.gooddata.com/gdui-starting-from-scratch-1I am using a GoodData.CN instance. After installing dependencies using ‘yarn install’ I ran the application using ‘yarn start’.The application launched and the Welcome page opened but the page kept reloading continuously. By debugging a bit I found that the useEffect in AuthProvider in context.js causes this continuous refresh.useEffect(() => { const auth = async () => { try { await backend.authenticate(); onLoginSuccess(); } catch (err) { // we do not care about the error in this context onLoginError({}); } }; auth(); // eslint-disable-next-line react-hooks/exhaustive-deps }, []);Am I missing any settings in my GoodData.CN instance?

3
jacek
GoodData Employee
8 months ago
gunit
gunitNew Participant
asked in SDKs and APIs

Where can I fund filter IDs for raw Report export?

Hi there,We have a dashboard with a report, but we also want to export report’s data and use a part of it in our internal BI tool. This page https://help.gooddata.com/doc/enterprise/en/expand-your-gooddata-platform/api-reference#operation/exportRawReport suggests that raw export can be filtered. I am trying to understand where can I find filter_id for this: { "uri": "/gdc/md/{project_id}/obj/{filter_id}", "constraint": { "type": "interval", "from": "2015-07-01", "to": "2015-07-10" } }Any help is greatly appreciated!

1
Julius Kos
GoodData Employee
8 months ago
P
plaubeKnown Participant
asked in SDKs and APIs

API error - GDC::Exception::NotFound

Hello, please help me.  I tried to get all users in my project over API reguest.  I got error message. What does it mean?  

44
Martin Burian
Community Manager
10 months ago
Q
Quentin GuilllonKnown Participant
asked in SDKs and APIs

Login and Logout APIs behaviour

Hello community!I’ve a question related to login/logout GoodData APIs that we are using, about a strange behaviour which is not blocking but for which we are curious to understand as it could hide a security defect. So, we implemented and tested the login + logout queries, as explained in the Good Data documentation here.https://help.gooddata.com/doc/enterprise/en/expand-your-gooddata-platform/api-reference#tag/login/paths/~1gdc~1account~1login/posthttps://help.gooddata.com/doc/enterprise/en/expand-your-gooddata-platform/api-reference#tag/logout/paths/~1gdc~1account~1login~1{userId}/delete The login query is working fine, however the logout query always fail, saying that the user is not logged in. Does somebody knows why we have this behaviour? There are only few differences between the logout and the login queries : in the logout, we have to precise the id of the user to logout at the end of the URL (coming from the feedback of the login query), a valid TT (Temporary Token), and use a

4
Q
10 months ago
Q
Quentin GuilllonKnown Participant
asked in SDKs and APIs

How to know where is stored a loading process?

Hi! As a big user of Good Data APIs, we implemented methods to properly create and delete source connections to our Amazon S3 containers.Still, I’m blocked by a conflict that I’m not sure how to solve : I cannot delete a datasource which should not be used anymore in our domain because a “loading process” is built in top of it (a technical layer, before the schedules definitions if I understood correctly). I found in the API that project by project, I can list all the loading process that has been declared in each : I cannot find back in any of my projects this blocking process (despite I’m administrator of the domain). Is there a way to get directly to a loading process knowing its ID, or listing all the loading process existing in a domain? And may my issue come from the fact that some projects or some loading processes may exist in a domain and the administrator is not allowed to see them?So frustrating because I do have the id of the loading process that is blocking me :5d10ffc9-ae

4
Q
11 months ago
Q
Quentin GuilllonKnown Participant
asked in SDKs and APIs

API login syntax - Error returned, what am I missing?

Hello all!I’m in a company that have worked in GoodData platform for a few months now, and to prepare our switching to the Growth plan (we are in free plan from now), I was trying to make the API calls work with a local software : Postman.Yet, despite the detailed documentation about APIs I found here : https://help.gooddata.com/doc/enterprise/en/expand-your-gooddata-platform/api-reference#section/Use-Cases, I was not able to even log in with Postman. I suppose something is missing, I receive an answer 400 - Bad request, but I’m not understanding what. Does somebody has an idea? Thanks in advance, I’ll help me a lot understanding what are the basics of the GoodData API I’m missing! NB : I’m precising that I’m the administrator of the Free Domain What I’m trying to call :Method : POSTURL : https://<my_company_domain>.on.gooddata.com/gdc/account/loginHeaders :   - Content-Type = application/json   - Accept = application/json   - User-Agent = PostmanRuntime-Login/7.28.0Body : {    

4
Q
1 year ago
D
Dilip.choudhuryNew Participant
asked in SDKs and APIs

API for SLI Hash rebuild

Currently, we rebuild SLI hash via Gooddata portal. We need to automate this process using Gooddata API. I could not find any online doc for this. Could anyone send me a complete example for the API in any language? I was told that the JSON body is as follows but I could not make it work using this limited information.{  "etlMode": {    "mode": "SLI",    "lookup":"recreate"  }} Thanks,DilipC. 

1
Moises Morales
GoodData Employee
1 year ago
A
alegarciNew Participant
asked in SDKs and APIs

How can I retrieve data from a gooddata table on cloud?

I would like to retrieve my information after it is saved on gooddata cloud. How can I do this?

3
Pavel
2 years ago
C
Cody PearceNew Participant
asked in SDKs and APIs

Creating schedule with manual schedule using Java SDK

Hello. How to create a schedule with a manual option using Java SDK rather than cron? Could you please share sample code/Documentation around this? Thank you. Cody

1
Boris
GoodData Employee
2 years ago
C
Cody PearceNew Participant
asked in SDKs and APIs

Deploying process using Java SDK

Hello. Are there any code samples/Documentation to deploy process using Java SDK. We are not able to find how to attach the snowflake data source to deploy process. Thank you. Cody

1
A
2 years ago
K
Keith FinnNew Participant
asked in SDKs and APIs

GoodData SDKs?

Is there a place where I can see SDK projects I can use?

3
Pavel
2 years ago
Welcome to the GoodData Community!Cookie settings