To GoodData homepage

Knowledge base
AnalyticsDashboards and Reports - KB articles8 Metrics and MAQL - KB articles22
Data modeling & IntegrationData models - KB articles8 Data sources - KB articles9
Development & AdministrationGoodData.UI - KB articles9 Administration - KB articles12 Solution architecture - KB articles8 SDKs and APIs - KB articles9
Community
WelcomeAbout GoodData16
AnalyticsDashboards and Reports76 Metrics and MAQL60
Data modeling & IntegrationData models26 Data sources50
Development & AdministrationGoodData.UI28 Administration61 Solution architecture5 SDKs and APIs15
GoodData For FreshdeskNews & Updates2 Got a question?3 General Information1

Ask your question
Login

Community
Search

Recently active topics

25 Topics

Recently active

Most views Most replies

Patrik BraborecCommunity Manager

published in Data models - KB articles

Simplified declarative API In GoodData.CN 2.0Tutorial

Hi Community, let us inform our users, mainly those who manage the data model via API, that we in GoodData simplified declarative API In GoodData.CN 2.0. It is no longer necessary to create a “primary label” definition. By design, primary labels will be automatically available in attributes of an entity API (with the same ID). If you are not using our Logical Data Model (LDM) modeler UI but manage your model manually via API, please ensure that your primary labels and attributes have the same ID. Otherwise, you may find that your dashboard will stop working with messages like:{...,"status":400,"detail":"An error has occurred during the calculation of the result","resultId":"b61422c23443","reason":"Cannot find label with id='label/label.gooddata.name/28cdfs43dw221134' in LDM”,...}Steps to avoid the mentioned problemGET /api/v1/entities/workspaces/<id>/labels?filter=primary==true&include=attribute - this will list you all primary labels and attributes. You will get similar resp

Documentation TeamModerator

GoodData Platform - August 11, 2022Release Notes - GoodData Platform

GoodData.UI Version 8.10 Available User Group Dashboard Permissions Propagate with the LCM Bricks New Default Behavior for Synchronizing User Groups New Default Behavior for Responsive and Pixel Perfect Shared Dashboards Users can now be Removed from User Groups GoodData.UI Version 8.10 AvailableWe have released Version 8.10 of GoodData.UI, our powerful library for building analytical applications powered by GoodData.What's new in GoodData.UI Version 8.10Support for Gooddata Cloud GoodData Cloud is now fully supported by GoodData.UI from version 8.10 Dashboard selectors are public now The filterContext, user, and permission selectors are now public. Execution definition by slices/series can be used without React You can use the @alpha version of DataViewLoader from @gooddata/sdk-ui Additional fixes and improvementsUser Group Dashboard Permissions Propagate with the LCM BricksThe release brick, provisioning brick, and the rollout brick now support User Group Dashboard Permissions. The

GD for Freshdesk QuestionsGoodData Employee

asked in Got a question?

Time Spent and Resolution Time wrong?

I am curious how the time spent and resolution time are calculated. Both of these numbers are not correct.

ShamboParticipating Frequently

asked in GoodData.UI

AttributeFilter width in GD.UI

We would like all AttributeFilters in our GD.UI app to be the same width, and not have each filter’s width vary by its label width.I’ve tried wrapping the AttributeFilter in div tags and adding a style param, but no dice.Thinking I may have to dig deeper into the css inside the AttributeFilter such as .gd-button-primary .gd-button-text or another class, I was able to edit those in chrome’s developer tools, and that did change filter widths. However, i tried editing the main.css file, but that also did not change the width.I would really prefer not to change main.css, actually, and set the filter widths wihin the .js file for this page itself. I searched on google how to override css styles and classes inline in js, but I couldn’t find any help.

Documentation TeamModerator

GoodData Cloud - August 11, 2022Release Notes - GoodData Cloud

New features Support for Filtering of Empty Attribute Values New featuresSupport for Filtering of Empty Attribute ValuesIn GoodData Cloud, attribute filters now support the empty (NULL) values.You can now include or exclude these empty values from your fiters in MAQL definitions or directly in Analytical Designer or Dashboards.Learn more:Filter Visualizations by Attributes and DatesRelational Operators

EmmanuelNew Participant

asked in Metrics and MAQL

Median query not working

Hi, I have a set of conversations logged in with DATE attribute. I’d like to measure the median count of conversation per day. However, when I enter something like SELECT MEDIAN(COUNT(conversation_id)) BY Date (Start Date)it doesn’t seem to work, and instead give me the total count, not the median count by date. Am I missing something? How could I get the median count of conversations? Thanks so much

greglindstromNew Participant

asked in Data sources

BigQuery and loading data

We are new to GoodData and would like to use our connection to BigQuery tables as our data source. Will we still need to 'load' data into GoodData or can the data remain in BigQuery?

SimonNew Participant

"Show zeroes" optionReceived

Add an option to show zeroes.I’ve spent hours trying to hack metrics together to show weeks/days/months where zero of something happened (amongst weeks/days/months where stuff happened), only to find you can’t “stack by” when you use ifnull. It’s necessary, as bunching two weeks together that have data, and missing the week with zero data, doesn’t show the full story when looking at business progress…Looks from Googling that many people want the ability to show periods where zero events happened on a graph involving time. There’s multiple guides around using ifnull, but it could be so much more user-friendly...A “Show periods with zero” tick box alongside the “Date as”, “group by”, “Display as:” options would be invaluable.

hpatskanNew Participant

Pass callback function into chart config to customize chart labels and datapointsReceived

Currently when using a date measure `year month` or `week in year` etc, the format of the data isn’t quite what we need. For example, week in year is an integer 1-53, but we need something like ‘dd/mm’ so it’s more human readable. Another feature that would be useful is to be able to “skip labels” so that we can display longer labels without truncating.So rather than break this up into multiple features or options, it’d be useful to have the ability to pass in a callback when configuring the charts for react components to be able to format the labels ourselves or return `null` or ‘’ to denote a label shouldn’t be rendered, chart.js has a similar feature to this for reference. Thanks,

Patrik BraborecCommunity Manager

published in SDKs and APIs - KB articles

Import GoodData OpenAPI schema to Postman API PlatformTutorial

It is heavily recommended to use the Postman API Platform for communication with GoodData API (of course if you do now want to communicate with GoodData API directly from code). In this post, I will explain how to import GoodData Open API schema to the Postman API Platform.PrerequisiteYou should have installed Postman API Platform on your computer. Step 1: Copy GoodData Open API schema URLhttps://www.gooddata.com/developers/cloud-native/doc/hosted/api-and-sdk/api/gooddata-cn-oapi-all-raw-schema.jsonStep 2: Open Postman API Platform and import GoodData API schemaClick the Import button in the left top corner:Click the Link tab and paste there the URL from the Step 1 and click the Continue button:Show advanced settings be sure that Folder organization is set to Tags:Click the Import button:GoodData Open API schema is successfully imported! 🎉🎉🎉Step 3: Set up API Token and GoodData URLOpen OpenAPI definition and click the Authorization tab:Select the Bearer Token:Put your API Token to t

Keith FinnNew Participant

asked in Metrics and MAQL

Grouping measures into folders in Analytical Designer

Is it possible to group existing metrics and calculated measures into folders in Analytical Designer?

Documentation TeamModerator

GoodData Platform - July 28, 2022Release Notes - GoodData Platform

Order of Items in Stacked Charts Support for Materialized Views for PostgreSQL and BigQuery Data SourcesOrder of Items in Stacked ChartsTo improve the readability of charts with stacked items (bar charts, column charts, and stacked area charts), you can now reverse the order of the items displayed.With the enableReversedStacking platform setting enabled, the order of the items will always corresponds with the left-to-right order in the legend.To enable this feature, set the enableReversedStacking platform setting to true. For details, see Configure Various Features via Platform Settings.Learn more:Stack MetricsConfigure Various Features via Platform Settings Support for Materialized Views for PostgreSQL and BigQuery Data SourcesBased on feedback from the Community Slack, we introduced support for Materialized Views for PostgreSQL and BigQuery Data Sources. Materialized views save computational resources while retaining the benefits of regular views.Materialized views now appear in the

Documentation TeamModerator

GoodData Cloud - July 28, 2022Release Notes - GoodData Cloud

New Features Order of Items in Stacked Charts New FeaturesOrder of Items in Stacked ChartsTo improve the readability of charts with stacked items, we have reversed the order of the items displayed.In bar charts, column charts, and stacked area charts, the order of the items now corresponds with the left-to-right order in the legend.

ShamboParticipating Frequently

asked in GoodData.UI

Export very large data sets in GD.UI

We have a PivotTable built in GD.UI that shows the error “too many data points to display”. We do NOT want to add filters.I know in the pixel perfect world we can create a Report (not an Insight) that will not display more than 60m cells but will allow the user to download/export all data associated with that Report.Is it possible to enable export of large data sets from PivotTables in GD.UI without filtering? thanks

jeferson.nunesParticipating Frequently

asked in Dashboards and Reports

BUTTON WITH ACCESS TO ANOTHER TAB

Would it be possible to create a button that, when clicked, would send the user to the screen II tab?This feature already exists when we build a report in table format. but I would like to know if there would be a way to create a button to direct the user.There is a tool available at https://s3.amazonaws.com/gd-images.gooddata.com/customtext/embed.html however it does not have this feature.

alejandro.riveraInspiring

asked in SDKs and APIs

Filter out future empty values

Hello,How can I create a metric that is going to filter empty values like the one below, by if an empty value doesn’t yet exist? In other words how can I make the filter so it filters out future empty values? select Customer Gender where Customer Gender not in ((empty value)) Thanks!

PD5Known Participant

asked in SDKs and APIs

API Error when creating a PostgreSQL data source

Hi, I'm not sure if anyone can help with this query. I'm currently using the GoodData API to set up a data source, but am receiving this error. It looks like "postgres" isn't a valid option for the connectionInfo even though the documentation says it is. Here is the error{"response":{"error":{"errorClass":"com.gooddata.validator.openapi.spring.exception.MalformedRequestException","trace":"","message":"Malformed request: [ERROR - [Path '/dataSource/connectionInfo'] Instance failed to match exactly one schema (matched 0 out of 10): [/properties/dataSource/properties/connectionInfo/oneOf/0: Object instance has properties which are not allowed by the schema: [\"postgres\"], /properties/dataSource/properties/connectionInfo/oneOf/0: Object has missing required properties ([\"snowflake\"]), /properties/dataSource/properties/connectionInfo/oneOf/1: Object instance has properties which are not allowed by the schema: [\"postgres\"], /properties/dataSource/properties/connectionInfo/oneOf/1: Objec

RichNew Participant

asked in About GoodData

Aust. Privacy Principles

Hi there, we have just embedded GoodData into our application and are based in Australia. Has anyone gone through the exercise of confirming that GoodData complies with Australian Privacy Principles?

Jan RehanekGoodData Employee

published in Administration - KB articles

Getting started with SSOTutorial

Single sign-on (SSO) is an important concept when it comes to working with GoodData.The purpose of this article is to help you explore the different SSO scenarios that GoodData supports and to make them clear even for those who are not very familiar with the concept. After reading, you should have a good idea about what options you have available.All the links to our documentation and relevant articles are included.To wrap things up, I’ll take advantage of our new self-service SSO API and show you an example of how to set up service provider-initiated SSO with Auth0 from scratch.Few keys things first: The SSO implementation for your domain is fully self-service - no action is needed from GoodData if you want to get started. Everything can be configured by your own domain admin via our SSO provider API. For our hosted platform, we support either SAML 2.0 or PGP-based authentication. We provide extensive documentation for both. Documentation page to get you started: Single Sign-on Ov

Documentation TeamModerator

GoodData.CN 2.0.1 Release NotesRelease Notes - GoodData.CN

Released July 20th, 2022. New FeaturesThis is a patch release. There are no new features since release 2.0.0.Fixes and UpdatesWe fixed the problem where the demo data were failing in the Brave browser and in Chrome with AdBlock extensions enabled. You can now add localhost addresses as allowed origins in the Cross-origin resource sharing (CORS). We fixed the bug where visualizations with additional filters in date filters could not be opened. We fixed the problem with URL validation in the direct login via URL. We fixed the bug where result-cache or sql-executor run out of memory. We removed the necessity of the manual FLUSH of redis after the upgrade. We changed the logging level of the SQL executor so that it logs only relevant information.Get the Community EditionPull the GoodData.CN Community Edition to get started with the latest release:docker pull gooddata/gooddata-cn-ce:2.0.1

Martin BurianCommunity Manager

published in About GoodData

Introducing "GoodData Cloud" 🎉News

We are thrilled to share GoodData's latest news with everyone. We've launched GoodData Cloud! Our CEO, Roman Stanek, discusses what led to us creating GoodData Cloud and what exactly it is here.

ZafarNew Participant

asked in Dashboards and Reports

Login page when sharing dashboard or using Embedded Dashboards

Hi, I am currently using Free version of GoodData Fully hosted solution I see a login page whenever i share dashboard with another user or use it as an embedded dashboard in HTML. Wanted to know this will always be the case if i use Enterprise or Growth plan ? and incase of GoodData.CN its still the same ? Thanks

Documentation TeamModerator

GoodData Cloud - July 14, 2022Release Notes - GoodData Cloud

Introducing GoodData Cloud GoodData Cloud is a fully managed, AWS-hosted product that takes advantage of the same technological advances introduced with GoodData.CN.It is consumed as a cloud platform component hosted by GoodData and fits natively into a company's ecosystem while providing enhanced features for analytics engineers, end users, and external data consumers.GoodData Cloud is currently available as an unpaid, time-limited trial plan and a paid Professional Subscription plan. Each Subscription plan comes with access to GoodData.UI, includes embedding capabilities, an API layer, and other tools and functionality as further described in the GoodData Documentation.GoodData Cloud runs on top of GoodData.CN, see release notes of GoodData.CN 2.0 to learn about the latest updates.

alejandro.riveraInspiring

asked in SDKs and APIs

How to create report domain?

Hello,Does anybody knows how to create a report folder (also known as domain) via the Ruby SDK?My report structure looks like the one below, I’ve marked in red the resource that I want to create. It seems that this model is only for folders for metrics and facts, not reports.GoodData Resource{ "report" : { "content" : { "definitions" : [ "/gdc/md/qplmsdfsdfsdfsdfsdfsdfsdfsdfsdfqv/obj/1111111" ], "domains" : [ "/gdc/md/qplmcrc1ytrn3d817ilflrkdgi6gs1qv/obj/241134" ] }, "meta" : { "author" : "/gdc/account/profile/sdfsdfsdf", "category" : "report", "contributor" : "/gdc/account/profile/sdfsdfsdf", "created" : "2022-06-24 19:37:08", "deprecated" : "0", "identifier" : "abv6eR9gfcCa", "isProduction" : 1, "summary" : "", "tags" : "", "title" : "Contacts by Category", "updated" : "2022-07-14 16:37:07", "uri" : "/gdc/md/csdfsdfsdff

Documentation TeamModerator

GoodData Platform - July 14, 2022Release Notes - GoodData Platform

Order of Items in Stacked Charts Salesforce Downloader API Parameter UpdatesOrder of Items in Stacked ChartsTo improve the readability of charts with stacked items (bar charts, column charts, and stacked area charts), we are reversing the order of the items displayed in the next update to the GoodData Platform.After the update, the order of the items will always corresponds with the left-to-right order in the legend.Learn more:Stack MetricsConfigure Various Features via Platform Settings Salesforce Downloader API Parameter UpdatesFor the Salesforce Downloader, the default value for the api_version parameter is now 53.0.Learn more:Salesforce Downloader

Powered by inSided

Welcome to the GoodData Community!Cookie settings

Sign up

Already have an account? Login

Social Login

or

Username (also your display name - please use John Doe rather than john.doe) *

E-mail address (if you already use GoodData, we encourage you to use the same e-mail address you use for the GoodData platform) *

Full Name

(Private)

Only you and moderators can see this information

*

Company

(Private)

Only you and moderators can see this information

*

I use the following GoodData products

(Private)

Only you and moderators can see this information

GoodData Platform GoodData Cloud GoodData.CN GoodData for Freshdesk

Password *

I have read and agree to the GoodData Community and University Terms of Use and Privacy Policy.

loginBox.register.email_repeat

Login to the community

Sign in with your community account. This is different than your login to your GoodData account. Don't have a community login? Create an account

Social Login

or

Username or Email

Password

Remember me

Forgot password?

Enter your username or e-mail address. We'll send you an e-mail with instructions to reset your password.

Username or e-mail

Back to overview

Scanning file for viruses.

Sorry, we're still checking this file's contents to make sure it's safe to download. Please try again in a few minutes.

OK

This file cannot be downloaded

Sorry, our virus scanner detected that this file isn't safe to download.

OK