To GoodData homepage

Topics started by alejandro.rivera

3 Topics

A
alejandro.riveraInspiring
asked in SDKs and APIs

Filter out future empty values

Hello,How can I create a metric that is going to filter empty values like the one below, by if an empty value doesn’t yet exist? In other words how can I make the filter so it filters out future empty values? select Customer Gender where Customer Gender not in ((empty value)) Thanks!

3
Jan Kos
GoodData Employee
1 year ago
A
alejandro.riveraInspiring
asked in SDKs and APIs

How to create report domain?

Hello,Does anybody knows how to create a report folder (also known as domain) via the Ruby SDK?My report structure looks like the one below, I’ve marked in red the resource that I want to create. It seems that this model is only for folders for metrics and facts, not reports.GoodData Resource{   "report" : {      "content" : {         "definitions" : [            "/gdc/md/qplmsdfsdfsdfsdfsdfsdfsdfsdfsdfqv/obj/1111111"         ],         "domains" : [            "/gdc/md/qplmcrc1ytrn3d817ilflrkdgi6gs1qv/obj/241134"         ]      },      "meta" : {         "author" : "/gdc/account/profile/sdfsdfsdf",         "category" : "report",         "contributor" : "/gdc/account/profile/sdfsdfsdf",         "created" : "2022-06-24 19:37:08",         "deprecated" : "0",         "identifier" : "abv6eR9gfcCa",         "isProduction" : 1,         "summary" : "",         "tags" : "",         "title" : "Contacts by Category",         "updated" : "2022-07-14 16:37:07",         "uri" : "/gdc/md/csdfsdfsdff

6
A
1 year ago
A
alejandro.riveraInspiring
asked in SDKs and APIs

Creating Reports via Ruby SDK

Hi, I’m Alejandro :)I'm working on automating report creation via the Ruby SDK.To be able to create reports, I was following these instructions: https://sdk.gooddata.com/gooddata-ruby-doc/docs/working_with_reportsBut this way of creating reports :project.compute_report(left: project.metrics.first, filters: [[label, :not, 'San Francisco', 'Prague']])only allows me to create filters as IN or NOT IN, per what I can see in the method itself.In my case I want to create a report with 2 filters with the expressions: Year is this year    (so this would be Attribute = Value)<attribute > where Contact is Valid is equal to 1. (so this would be attribute where metric is equal to 1)How can I accomplish this? I can't seem to find examples or good enough information related to this or how to do it.I'll appreciate any help,ThanksAlejandro

3
Jan Rehanek
GoodData Employee
1 year ago
Welcome to the GoodData Community!Cookie settings