Hello,
Does anybody knows how to create a report folder (also known as domain) via the Ruby SDK?
My report structure looks like the one below, I’ve marked in red the resource that I want to create. It seems that this model is only for folders for metrics and facts, not reports.
GoodData Resource
{
"report" : {
"content" : {
"definitions" : [
"/gdc/md/qplmsdfsdfsdfsdfsdfsdfsdfsdfsdfqv/obj/1111111"
],
"domains" : [
"/gdc/md/qplmcrc1ytrn3d817ilflrkdgi6gs1qv/obj/241134"
]
},
"meta" : {
"author" : "/gdc/account/profile/sdfsdfsdf",
"category" : "report",
"contributor" : "/gdc/account/profile/sdfsdfsdf",
"created" : "2022-06-24 19:37:08",
"deprecated" : "0",
"identifier" : "abv6eR9gfcCa",
"isProduction" : 1,
"summary" : "",
"tags" : "",
"title" : "Contacts by Category",
"updated" : "2022-07-14 16:37:07",
"uri" : "/gdc/md/csdfsdfsdffsdfqv/obj/174472"
}
}
}
Thanks!
Best answer by Jan Rehanek
View original